PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000131218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 483aa    MW: 53324 Da    PI: 6.7567
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000131218genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY76.92.3e-24165221259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    +DgynWrKYGqK+vk+ + +rsYYrCt+++C +kk +e++++ ++v++i+Y+++H+h+
  MDP0000131218 165 SDGYNWRKYGQKQVKSPQGSRSYYRCTYSECYAKK-IECCDHSGHVTDIVYKSQHTHD 221
                    7********************************98.*********************7 PP

2WRKY98.15.7e-31346402359
                    -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ +++++v+itY+g H+h+
  MDP0000131218 346 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIETAVDNTSAVIITYKGVHDHD 402
                    9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182902.75E-19162223IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.4E-20162223IPR003657WRKY domain
SMARTSM007742.4E-23164222IPR003657WRKY domain
PROSITE profilePS5081117.19165223IPR003657WRKY domain
PfamPF031063.2E-17166221IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.9E-32329404IPR003657WRKY domain
PROSITE profilePS5081131.766339404IPR003657WRKY domain
SuperFamilySSF1182903.14E-27340404IPR003657WRKY domain
SMARTSM007741.8E-35344403IPR003657WRKY domain
PfamPF031061.2E-23346401IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MAEHHESSDA LPTEKLHPRK GEQEEGGSGD EDDDEERKQR LGEFQPGELK SSVSELRQTQ  60
LXTLMEPSTQ EFSEKDQFAG LQLESVSQSI DGAELQEQLG LXHQEILASV TNQXVQIQKQ  120
SQSQLTVYPT PFSELSPTSV TQSISSAPSP ILIERRVPHG KTSASDGYNW RKYGQKQVKS  180
PQGSRSYYRC TYSECYAKKI ECCDHSGHVT DIVYKSQHTH DPPRKSICXK ESKLALSAEC  240
VXYSVAPAEH SYRTVNDSEV STSSKEPIQE TPSVPERKRQ SASDSDDNGD VKIKEENGDG  300
DEPEPKRRQV YLMKKSKSEY SASLSKPGKK PKFVVHAAGD VGISGDGYRW RKYGQKMVKG  360
NPHPRNYYRC TSAGCPVRKH IETAVDNTSA VIITYKGVHD HDMPVPKKRH GPPSAPLVAA  420
AAPASMNSLH IKKTDTVPNQ ISSTQWSVDT GGELTGEALD LGGEKAMESA RTLLSIGFEI  480
KPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A7e-26332404274WRKY transcription factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.232720.0bud| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008394322.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-130WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLM5W7R30.0M5W7R3_PRUPE; Uncharacterized protein
STRINGVIT_11s0037g00150.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51983456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-121WRKY DNA-binding protein 32